CagriSema Blend combines:<\/p>\n
Rather than representing a new peptide, CagriSema combines two well-characterised investigational compounds with complementary biological mechanisms.<\/p>\n
Semaglutide is a GLP-1 receptor agonist<\/strong>, while Cagrilintide is a long-acting amylin analogue<\/strong>. Together they allow researchers to investigate two hormonal pathways that regulate appetite, satiety, gastric emptying and energy balance through different physiological mechanisms.<\/p>\n Among all current metabolic peptide combinations, CagriSema has one of the strongest clinical evidence bases<\/strong>.<\/p>\n The individual components contribute complementary biology.<\/p>\n Semaglutida<\/strong><\/p>\n Cagrilintida<\/strong><\/p>\n Because these pathways regulate food intake through different mechanisms, CagriSema has become one of the leading investigational combinations in obesity and metabolic research<\/strong>.<\/p>\n Semaglutide (5 mg)<\/strong><\/p>\n A GLP-1 receptor agonist with an extensive clinical evidence base across obesity and metabolic research. Published studies have established Semaglutide as one of the foundational compounds in modern incretin biology.<\/p>\n Cagrilintide (5 mg)<\/strong><\/p>\n A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it targets amylin receptors rather than GLP-1 receptors, it provides complementary metabolic signalling.<\/p>\n One of the major goals in metabolic research is to investigate whether targeting multiple hormonal pathways produces broader physiological effects<\/strong> than activating a single receptor system.<\/p>\n Semaglutide provides GLP-1 receptor agonism<\/strong>.<\/p>\n Cagrilintide provides amylin receptor signalling<\/strong>.<\/p>\n Unlike many experimental peptide blends, this combination has been evaluated in multiple human clinical studies<\/strong>, which demonstrated greater weight reduction than either Semaglutide or Cagrilintide alone<\/strong> while maintaining an acceptable tolerability profile. These findings have established CagriSema as one of the most extensively investigated combination therapies in metabolic research.<\/p>\n CagriSema has one of the strongest evidence bases among investigational metabolic peptide combinations.<\/p>\n Published Phase II and Phase III studies have investigated the combination in adults with obesity and type 2 diabetes, reporting significant improvements in body weight and glycaemic control compared with the individual components. Ongoing REDEFINE and REIMAGINE clinical programmes continue to evaluate its long-term efficacy and safety.<\/p>\n Unlike many research blends, CagriSema is supported by dedicated combination trials<\/strong> rather than only by studies of its individual peptides.<\/p>\n CagriSema<\/strong><\/p>\n CagriTirz<\/strong><\/p>\n CagriReta<\/strong><\/p>\n Researchers select between these formulations based on the metabolic pathways they wish to investigate and the available clinical evidence.<\/p>\n Published safety data for CagriSema primarily describe gastrointestinal adverse events, including nausea, vomiting, diarrhoea and decreased appetite, particularly during dose escalation<\/strong>. Across clinical studies, these events were generally mild to moderate and consistent with the known safety profiles of GLP-1 receptor agonists and amylin analogues.<\/p>\n Aplicaci\u00f3n: investigaci\u00f3n de laboratorio y an\u00e1lisis Almacenamiento<\/strong>: los viales liofilizados sin abrir se almacenan mejor refrigerar a 2\u20138 \u00b0C<\/strong>, que es el m\u00e9todo de almacenamiento confirmado por nuestro socio de fabricaci\u00f3n y adecuado para hasta 24 meses. Se prefiere la refrigeraci\u00f3n porque minimiza los ciclos innecesarios de congelaci\u00f3n y descongelaci\u00f3n durante la manipulaci\u00f3n rutinaria. Si se requiere un almacenamiento a m\u00e1s largo plazo, los viales liofilizados sin abrir tambi\u00e9n pueden mantenerse congelados. Una vez reconstituidos, almacene siempre a 2\u20138 \u00b0C y no congele.<\/p>\n The landmark Phase II trial demonstrating greater weight reduction and improved glycaemic control with the combination compared with either peptide alone.<\/p>\n A pivotal study supporting continued development of the fixed-dose combination and providing additional efficacy and safety data.<\/p>\n The foundational Phase II study establishing Cagrilintide as a leading long-acting amylin analogue.<\/p>\n The landmark STEP-1 trial establishing Semaglutide as a cornerstone of modern obesity and metabolic research.<\/p>\n What is CagriSema Blend?<\/strong><\/p>\n CagriSema Blend combines Cagrilintide (5 mg) and Semaglutide (5 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin and GLP-1 receptor signalling.<\/p>\n Which peptides are included in CagriSema?<\/strong><\/p>\n Each vial contains:<\/p>\n Together these peptides target two complementary hormonal systems involved in appetite regulation, satiety, gastric emptying and energy balance.<\/p>\n Why are Cagrilintide and Semaglutide combined?<\/strong><\/p>\n Semaglutide activates the GLP-1 receptor, while Cagrilintide is a long-acting amylin analogue. Because they regulate metabolism through different physiological pathways, researchers investigate the combination to better understand complementary metabolic signalling. Unlike many peptide blends, this combination has been evaluated in dedicated human clinical trials.<\/p>\n What research areas commonly investigate CagriSema Blend?<\/strong><\/p>\n Published research has investigated CagriSema in appetite regulation, satiety signalling, body-weight regulation, energy balance, gastric emptying, glycaemic control and complementary amylin\u2013GLP-1 biology.<\/p>\n How does CagriSema differ from CagriTirz?<\/strong><\/p>\n Both blends contain Cagrilintide, but CagriSema combines it with Semaglutide, while CagriTirz combines it with Tirzepatide. CagriTirz adds GIP receptor agonism, whereas CagriSema is currently supported by the most extensive dedicated clinical evidence for an amylin\u2013GLP-1 combination.<\/p>\n Can research on CagriSema be applied directly to this blend?<\/strong><\/p>\n Yes, unlike many research blends, CagriSema has been investigated as a fixed-dose combination in dedicated clinical studies. While this research relates to pharmaceutical formulations used in those trials rather than this specific product, it provides direct evidence for the biological combination of Cagrilintide and Semaglutide.<\/p>\n \u00bfEst\u00e1 este producto destinado al uso humano?<\/strong><\/p>\n No. CagriSema Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the scientific literature relating to the peptide combination rather than the intended use of this product.<\/p>\n Cagrilintide \/ Semaglutide combines amylin analogue signaling with GLP-1 receptor activation, forming a dual-pathway metabolic research model.<\/p>\n For comparative frameworks, researchers may also examine:<\/p>\n Semaglutida<\/a> \u2014 GLP-1 receptor agonist This combination is commonly positioned in research exploring satiety signaling alongside incretin-mediated metabolic regulation.<\/p>\n For additional context, see the Gu\u00eda de investigaci\u00f3n metab\u00f3lica de GLP-1<\/a> and related compounds within the Metabolic research category<\/a>.<\/p>\n NOTA<\/strong>: Esto es solo para fines de referencia educativa y no constituye asesoramiento m\u00e9dico.<\/p>\n Descargo de responsabilidad<\/strong> CagriSema Blend 10 mg is a research-grade metabolic peptide formulation combining Cagrilintide (5 mg) and Semaglutide (5 mg) in a single lyophilised vial. Designed for laboratory research, it combines amylin and GLP-1 receptor signalling\u2014two complementary pathways that have become one of the most extensively investigated combinations in modern metabolic research.<\/p>\n ||<\/p>\n Purity \u226598% | EU shipping from \u20ac5 | Free shipping upgrades available | Card payments accepted<\/p>","protected":false},"featured_media":1050,"comment_status":"open","ping_status":"closed","template":"","meta":[],"product_brand":[],"product_cat":[19],"product_tag":[257,248,160,139,247,153,156,252,159,246,316],"class_list":["post-1057","product","type-product","status-publish","has-post-thumbnail","product_cat-metabolic-research-peptides","product_tag-appetite-regulation","product_tag-energy-balance","product_tag-energy-balance-research","product_tag-glp-1-research","product_tag-metabolic-peptide","product_tag-metabolic-research","product_tag-multi-receptor-agonist","product_tag-obesity-research","product_tag-satiety-signaling","product_tag-weight-loss-peptide","product_tag-weight-management-research","first","instock","taxable","shipping-taxable","purchasable","product-type-simple"],"_links":{"self":[{"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/product\/1057","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/product"}],"about":[{"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/types\/product"}],"replies":[{"embeddable":true,"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/comments?post=1057"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/media\/1050"}],"wp:attachment":[{"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/media?parent=1057"}],"wp:term":[{"taxonomy":"product_brand","embeddable":true,"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/product_brand?post=1057"},{"taxonomy":"product_cat","embeddable":true,"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/product_cat?post=1057"},{"taxonomy":"product_tag","embeddable":true,"href":"https:\/\/life-peptide.com\/es\/wp-json\/wp\/v2\/product_tag?post=1057"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}
\nWhy CagriSema matters in metabolic research<\/strong><\/h4>\n
\n
\n
\nThe two components of CagriSema<\/strong><\/h4>\n
Why researchers combine Cagrilintide with Semaglutide<\/strong><\/h4>\n
Investigaci\u00f3n humana y precl\u00ednica<\/strong><\/h4>\n
How CagriSema differs from other metabolic blends<\/strong><\/h4>\n
\n
\n
\n
Consideraciones de seguridad publicadas<\/strong><\/h4>\n
\nCaracter\u00edsticas del producto<\/strong><\/h4>\n
\nUso restringido: no apto para consumo humano; no apto para uso m\u00e9dico, veterinario o cosm\u00e9tico
\nProducido en instalaciones que cumplen con GMP bajo estrictos protocolos de control de calidad.
\nCada lote se somete a pruebas de laboratorio exhaustivas despu\u00e9s de la producci\u00f3n (puede encontrar el Certificado de An\u00e1lisis debajo de las im\u00e1genes del producto).
\nLiofilizado (liofilizado) para m\u00e1xima estabilidad y vida \u00fatil prolongada.
\nSellado en viales est\u00e9riles, listo para la reconstituci\u00f3n.
\nPureza: \u2265 98% (HPLC)
\nApariencia: polvo blanco liofilizado
\nComposition: Cagrilintide 5 mg + Semaglutide 5 mg
\nMolecular formula Cagrilintide \/ Semaglutide: C194<\/sub>H312<\/sub>N54<\/sub>O59<\/sub> S2<\/sub> \/ C187<\/sub>H291<\/sub>N4<\/sub>5<\/sub>O59<\/sub>
\nMolecular weight Cagrilintide \/ Retatrutide: 4409.01 \/ 4113.64
\nSequence Cagrilintide: {diacid-C20-\u03b3-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
\nSequence Semaglutide: H-Aib-EGTFTSDVSSYLEGQAA-K(18Oct-\u03b3-Glu-AEEA-AEEA)-EFIAWLVRGRG<\/p>\n
\nEstudios clave publicados<\/strong><\/h4>\n
\n
\n
\n
\n
\nPreguntas Frecuentes<\/strong><\/h4>\n
\n
\nContexto de investigaci\u00f3n relacionado<\/strong><\/h4>\n
\nCagrilintida<\/a> \u2014 amylin analogue
\nTirzepatida<\/a> \u2014 GLP-1\/GIP dual agonist
\nCagri-based blends \u2014 extended combination models<\/p>\n
\nEste producto se vende \u00fanicamente para fines de investigaci\u00f3n. No est\u00e1 destinado a diagnosticar, tratar, curar ni prevenir ninguna enfermedad. El comprador asume toda la responsabilidad por su manipulaci\u00f3n y uso adecuados.<\/p>","protected":false},"excerpt":{"rendered":"