Ανάμειξη Cagrilintide 5 mg + Tirzepatide 10 mg

Περιγραφή

CagriTirz Blend combines:

• Cagrilintide – 5 mg
• Tirzepatide – 10 mg

Rather than representing a novel peptide, CagriTirz combines two investigational metabolic compounds with complementary mechanisms. Tirzepatide is a dual GLP-1/GIP receptor agonist, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate three major hormonal pathways involved in appetite regulation, satiety and metabolic homeostasis.

Why CagriTirz matters in metabolic research

Modern obesity research increasingly investigates therapies that target multiple hormonal pathways simultaneously.

The components of CagriTirz contribute different biological mechanisms.

Τιρζεπατίδη

• GLP-1 receptor agonism
• GIP receptor agonism
• incretin biology
• metabolic regulation
• glucose homeostasis

Καγκριλιντίδη

• amylin receptor signalling
• satiety biology
• gastric emptying
• appetite regulation

Together they represent three complementary endocrine pathways that regulate food intake and energy balance.

Unlike some experimental blends, this combination already has encouraging preclinical combination data, although dedicated human clinical trials of the formulation itself are not yet available.

The two components of CagriTirz

Tirzepatide (10 mg)

A dual GLP-1/GIP receptor agonist investigated extensively in obesity and metabolic research. Clinical studies have established Tirzepatide as one of the most important next-generation incretin peptides for body-weight regulation and glycaemic control.

Cagrilintide (5 mg)

A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it acts independently of incretin receptors, it complements GLP-1/GIP biology rather than duplicating it.

Why researchers combine Cagrilintide with Tirzepatide

One of the major goals in metabolic research is to activate different hormonal systems that regulate food intake.

Tirzepatide targets GLP-1 and GIP receptors.

Cagrilintide targets amylin receptors.

This complementary receptor profile has made the combination increasingly attractive in experimental metabolic research. Recent preclinical studies have reported greater reductions in food intake and body weight than either peptide alone, supporting continued investigation of this combination. These findings should be interpreted as early-stage research and not as evidence of clinical efficacy for the blend.

Ανθρώπινη και προκλινική έρευνα

There are currently no large Phase II or Phase III clinical trials evaluating the complete CagriTirz formulation.

However, the scientific rationale is supported by:

• extensive Phase III clinical research on Tirzepatide
• Phase II clinical development of Cagrilintide
• published preclinical studies evaluating the combination
• broader evidence supporting complementary amylin and incretin biology

Accordingly, CagriTirz should be viewed as a research formulation built from individually investigated peptides with emerging combination evidence rather than as a clinically validated blend.

How CagriTirz differs from other metabolic blends

CagriTirz

• Καγκριλιντίδη
• Τιρζεπατίδη
• Three metabolic pathways
• Amylin + GLP-1 + GIP

CagriSema

• Καγκριλιντίδη
• Semaglutide
• Amylin + GLP-1

CagriReta

• Καγκριλιντίδη
• Ρετατρουτίδη
• Amylin + GLP-1 + GIP + glucagon

CagriTirz occupies the middle of the spectrum, combining dual incretin biology with amylin signalling while avoiding glucagon receptor agonism.

Published safety considerations

Published safety information for CagriTirz is derived from studies of Cagrilintide and Tirzepatide individually.

Both peptides have primarily been associated with gastrointestinal adverse events such as nausea, vomiting, diarrhoea and decreased appetite during dose escalation. Because dedicated clinical trials of the combined formulation are not yet available, current safety understanding should be based on the evidence for each component separately.

Χαρακτηριστικά προϊόντος

Εφαρμογή: εργαστηριακή και αναλυτική έρευνα
Χρήση περιορισμού: όχι για ανθρώπινη κατανάλωση· όχι για ιατρική, κτηνιατρική ή καλλυντική χρήση
Παράγεται σε εγκαταστάσεις που συμμορφώνονται με τις ΟGMP υπό αυστηρά πρωτόκολλα ΠΚ.
Κάθε παρτίδα ελέγχεται προσεκτικά στο εργαστήριο μετά την παραγωγή (μπορείτε να βρείτε το Πιστοποιητικό Ανάλυσης κάτω από τις εικόνες του προϊόντος).
Κατάψυξη-αποξήρανση (λυσόφιλη) για μέγιστη σταθερότητα και παρατεταμένη διάρκεια ζωής.
Σφραγισμένα σε αποστειρωμένες φιάλες, έτοιμα για ανασύσταση.
Καθαρότητα: ≥ 98% (HPLC)
Εμφάνιση: λευκή λυοφιλοποιημένη σκόνη
Composition: Cagrilintide 5 mg + Tirzepatide 10 mg
Molecular formula Cagrilintide / Tirzepatide: C₁₉₄H₃₁₂N₅₄O₅₉ S₂ / C₂₂₅H₃₄₈N₄₈O₅₉
Molecular weight Cagrilintide / Tirzepatide: 4409.01 / 4813.45
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Tirzepatide: Y{Aib}EGTFTSDYSI{Aib}LDKIAQ-K{diacid-C20-γ-Glu-(AEEA)2}-AFVQWLIAGGPSSGAPPPS-NH2

Αποθήκευση: τα αφυδατωμένα σε ξηρή ψύξη, σφραγισμένα φιαλίδια φυλάσσονται καλύτερα συντήρηση στους 2–8°C, η οποία είναι η μέθοδος αποθήκευσης που επιβεβαιώθηκε από τον συνεργάτη παραγωγής μας και είναι κατάλληλη για έως και 24 μήνες. Η ψύξη προτιμάται επειδή ελαχιστοποιεί τους περιττούς κύκλους ψύξης-απόψυξης κατά τον συνήθη χειρισμό. Εάν απαιτείται σημαντικά μακροχρόνια αποθήκευση, τα σφραγισμένα λυοφιλοποιημένα φιαλίδια μπορούν επίσης να διατηρηθούν κατεψυγμένα. Μόλις ανασυσταθεί, αποθηκεύετε πάντα σε 2–8°C και μην καταψύχετε.

Ανα

CagriTirz is supplied as a lyophilised vial and should be handled using standard peptide reconstitution procedures appropriate to the research setting. Must be reconstituted with Βακτηριοστατικό νερό πριν τη χρήση. Για να διατηρηθεί η δομική ακεραιότητα, προσθέστε το επιλεγμένο διαλύτη αργά στο εσωτερικό τοίχωμα του φιαλιδίου αντί απευθείας στη μάζα του πεπτιδίου, και αποφύγετε το έντονο ανακίνημα. Η απαλή περιστροφή είναι γενικά επαρκής μόλις το πεπτίδιο διαλυθεί πλήρως. Η τυπική εργαστηριακή πρακτική περιλαμβάνει επίσης την αναμονή των ψυχόμενων φιαλιδίων να φτάσουν σε θερμοκρασία δωματίου πριν από την ανασύσταση για να ελαχιστοποιηθεί η συμπύκνωση στο εσωτερικό του φιαλιδίου.

Για την επιλογή άλλων διαλυτών, σχεδιασμό συγκεντρώσεων και οδηγίες αποθήκευσης, δείτε το πλήρες Οδηγός Ανασύστασης Πεπτιδίων και Υπολογιστής Απεικόνισης.

Βασικές δημοσιευμένες μελέτες

• Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021.

The landmark Phase II trial establishing Cagrilintide as a leading long-acting amylin analogue.

• Jastreboff AM, et al. Tirzepatide Once Weekly for the Treatment of Obesity. New England Journal of Medicine, 2022.

The pivotal Phase III SURMOUNT-1 trial establishing Tirzepatide as one of the leading dual incretin therapies for obesity research.

• Valdecantos P, et al. Beneficial Effect of the Combination Therapy of Cagrilintide and Tirzepatide. Diabetes, 2024.

Preclinical research demonstrating greater reductions in food intake and body weight with the combination than with either peptide alone, supporting further investigation of combined amylin and incretin signalling.

• D’Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity. Cardiology in Review, 2024.

A comprehensive review of amylin biology, Cagrilintide pharmacology and its role in next-generation metabolic therapies.

Συχνές Ερωτήσεις

What is CagriTirz Blend?

CagriTirz Blend combines Cagrilintide (5 mg) and Tirzepatide (10 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin, GLP-1 and GIP signalling.

Which peptides are included in CagriTirz?

Each vial contains:

• Cagrilintide – 5 mg
• Tirzepatide – 10 mg

Together these peptides provide three complementary hormonal pathways commonly investigated in appetite regulation, satiety and metabolic research.

Why are Cagrilintide and Tirzepatide combined?

Tirzepatide activates GLP-1 and GIP receptors, while Cagrilintide is a long-acting amylin analogue. Because they target different physiological systems, researchers investigate the combination to better understand complementary metabolic signalling. Experimental preclinical studies have also explored this combination, although dedicated human clinical trials are not yet available.

What research areas commonly investigate CagriTirz Blend?

Based on the published literature for its individual components, CagriTirz is relevant to research involving appetite regulation, satiety signalling, body-weight regulation, energy balance, gastric emptying, incretin biology and amylin receptor signalling.

How does CagriTirz differ from CagriReta?

Both blends contain Cagrilintide, but CagriTirz combines it with Tirzepatide, providing amylin, GLP-1 and GIP receptor activity. CagriReta combines Cagrilintide with Retatrutide, adding glucagon receptor agonism and expanding the receptor profile to four metabolic pathways.

Can research on Cagrilintide and Tirzepatide be applied directly to the blend?

Not completely. Both peptides have substantial independent clinical literature, and encouraging preclinical studies have investigated the combination. However, there are currently no large clinical trials evaluating the CagriTirz formulation itself, so findings should be interpreted within that context.

Αυτό το προϊόν προορίζεται για ανθρώπινη χρήση;

No. CagriTirz Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the current scientific literature relating to the individual peptide components rather than the intended use of the combined formulation.

Σχετικό ερευνητικό πλαίσιο

Cagrilintide / Tirzepatide integrates amylin receptor signaling with dual incretin agonism (GLP-1 and GIP), forming a multi-hormonal metabolic research framework.
Researchers comparing signaling depth across compounds may also examine:

Τιρζεπατίδη — dual incretin agonist (GLP-1/GIP)
Καγκριλιντίδη — amylin analogue
Ρετατρουτίδη — triple-receptor agonist
Semaglutide — single-pathway GLP-1 agonist

This blend is particularly relevant in studies focused on multi-layered endocrine signaling and combined satiety + incretin pathway interaction.
For additional context, see the Οδηγός μεταβολικής έρευνας GLP-1 and related compounds within the Μεταβολική έρευνα κατηγορία.

ΣΗΜΕΙΩΣΗ: Αυτό είναι μόνο για εκπαιδευτική αναφορά και δεν αποτελεί ιατρική συμβουλή.

Αποποίηση ευθύνης
Αυτό το προϊόν πωλείται αποκλειστικά για ερευνητικούς σκοπούς. Δεν προορίζεται για τη διάγνωση, θεραπεία, ίαση ή πρόληψη οποιασδήποτε ασθένειας. Ο αγοραστής αναλαμβάνει πλήρως την ευθύνη για τον σωστό χειρισμό και τη χρήση.