X

Blend Cagrilintide 5 mg + Tirzepatide 10 mg

160,00 

Cagrilintide / Tirzepatide blend combining amylin and dual incretin pathways for metabolic research models.

HPLC Purity ≥98% | Lyophilized | Research grade | EU-based supply | Free EU shipping over €100

Vorrätig

Beschreibung

Amylin + dual incretin blend

Cagrilintide / Tirzepatide is a combination peptide blend investigated for its interaction with amylin receptor pathways alongside dual incretin signaling (GLP-1 and GIP).
This blend is studied in advanced metabolic models examining the integration of satiety signaling with incretin-mediated glucose and energy regulation. Compared to single or dual agonists alone, this combination allows broader investigation of hormonal interaction networks.
It is particularly relevant in comparative studies of dual vs multi-pathway metabolic signaling systems.

Research applications (investigational)

This combination has been explored in research settings for:

  • Amylin + GLP-1/GIP pathway interaction
  • Appetite and satiety signaling integration
  • Glucose regulation across dual incretin pathways
  • Energy balance and endocrine coordination models
  • Combination peptide research frameworks
  • Comparative analysis vs triple agonist systems

These areas reflect ongoing scientific investigation into complex metabolic signaling rather than established applications.

Product characteristics

Purity: ≥ 98% (HPLC)
Appearance: white lyophilized powder
Composition: Cagrilintide 5 mg + Tirzepatide 10 mg
Molecular formula Cagrilintide / Tirzepatide: C194H312N54O59 S2 / C225H348N48O59
Molecular weight Cagrilintide / Tirzepatide: 4409.01 / 4813.45
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Tirzepatide: Y{Aib}EGTFTSDYSI{Aib}LDKIAQ-K{diacid-C20-γ-Glu-(AEEA)2}-AFVQWLIAGGPSSGAPPPS-NH2
Storage: store lyophilized powder at -20°C, protect from light and moisture. Reconstituted solution should be kept at 2–8°C and used within a short period.

Why choose this blend

Dual incretin + amylin pathway integration
≥ 98% purity verified by HPLC.
Produced in GMP-compliant facilities under strict QC protocols.
Each batch carefully lab tested after production (Certificate of Analysis available under product pictures).
Freeze-dried (lyophilized) for maximum stability and extended shelf life.
Sealed in sterile vials, ready for reconstitution.
Reconstitution: requires careful reconstitution with bacteriostatic water. Peptides in this class may dissolve gradually and should be handled gently to maintain solution clarity.

Selected research references

  • Lau J et al. Amylin analogue signaling research. Journal of Medicinal Chemistry, 2021.
  • Jastreboff AM et al. Dual incretin agonists in metabolic research. New England Journal of Medicine, 2022.
  • Frias JP et al. Tirzepatide and incretin-based models. The Lancet, 2021.
  • Knop FK et al. Multi-hormonal metabolic pathway integration. Nature Reviews Endocrinology, 2023.

Related research context

Cagrilintide / Tirzepatide integrates amylin receptor signaling with dual incretin agonism (GLP-1 and GIP), forming a multi-hormonal metabolic research framework.
Researchers comparing signaling depth across compounds may also examine:

Tirzepatid — dual incretin agonist (GLP-1/GIP)
Cagrilintid — amylin analogue
Retatrutid — triple-receptor agonist
Semaglutid — single-pathway GLP-1 agonist

This blend is particularly relevant in studies focused on multi-layered endocrine signaling and combined satiety + incretin pathway interaction.
For additional context, see the GLP-1 metabolic research guide and related compounds within the Metabolic research category.

NOTE: This is for educational reference only and does not constitute medical advice.

Disclaimer
This product is sold for research purposes only. It is not intended to diagnose, treat, cure, or prevent any disease. Buyer assumes full responsibility for proper handling and use.

Rezensionen

Es gibt noch keine Rezensionen.

Schreibe die erste Rezension für „Blend Cagrilintide 5 mg + Tirzepatide 10 mg“

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert

Ähnliche Produkte