Blend Cagrilintide 5 mg + Semaglutide 5 mg

Descripción

CagriSema Blend combines:

• Cagrilintide – 5 mg
• Semaglutide – 5 mg

Rather than representing a new peptide, CagriSema combines two well-characterised investigational compounds with complementary biological mechanisms.

Semaglutide is a GLP-1 receptor agonist, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate two hormonal pathways that regulate appetite, satiety, gastric emptying and energy balance through different physiological mechanisms.

Why CagriSema matters in metabolic research

Among all current metabolic peptide combinations, CagriSema has one of the strongest clinical evidence bases.

The individual components contribute complementary biology.

Semaglutida

• GLP-1 receptor agonism
• appetite regulation
• señalización de incretinas
• glucose homeostasis
• metabolic regulation

Cagrilintida

• amylin receptor signalling
• satiety biology
• gastric emptying
• appetite regulation

Because these pathways regulate food intake through different mechanisms, CagriSema has become one of the leading investigational combinations in obesity and metabolic research.

The two components of CagriSema

Semaglutide (5 mg)

A GLP-1 receptor agonist with an extensive clinical evidence base across obesity and metabolic research. Published studies have established Semaglutide as one of the foundational compounds in modern incretin biology.

Cagrilintide (5 mg)

A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it targets amylin receptors rather than GLP-1 receptors, it provides complementary metabolic signalling.

Why researchers combine Cagrilintide with Semaglutide

One of the major goals in metabolic research is to investigate whether targeting multiple hormonal pathways produces broader physiological effects than activating a single receptor system.

Semaglutide provides GLP-1 receptor agonism.

Cagrilintide provides amylin receptor signalling.

Unlike many experimental peptide blends, this combination has been evaluated in multiple human clinical studies, which demonstrated greater weight reduction than either Semaglutide or Cagrilintide alone while maintaining an acceptable tolerability profile. These findings have established CagriSema as one of the most extensively investigated combination therapies in metabolic research.

Investigación humana y preclínica

CagriSema has one of the strongest evidence bases among investigational metabolic peptide combinations.

Published Phase II and Phase III studies have investigated the combination in adults with obesity and type 2 diabetes, reporting significant improvements in body weight and glycaemic control compared with the individual components. Ongoing REDEFINE and REIMAGINE clinical programmes continue to evaluate its long-term efficacy and safety.

Unlike many research blends, CagriSema is supported by dedicated combination trials rather than only by studies of its individual peptides.

How CagriSema differs from other metabolic blends

CagriSema

• Cagrilintida
• Semaglutida
• Amylin + GLP-1
• Most clinically investigated combination

CagriTirz

• Cagrilintida
• Tirzepatida
• Amylin + GLP-1 + GIP
• Emerging combination research

CagriReta

• Cagrilintida
• Retatrutida
• Amylin + GLP-1 + GIP + glucagon
• Next-generation experimental receptor profile

Researchers select between these formulations based on the metabolic pathways they wish to investigate and the available clinical evidence.

Consideraciones de seguridad publicadas

Published safety data for CagriSema primarily describe gastrointestinal adverse events, including nausea, vomiting, diarrhoea and decreased appetite, particularly during dose escalation. Across clinical studies, these events were generally mild to moderate and consistent with the known safety profiles of GLP-1 receptor agonists and amylin analogues.

Características del producto

Aplicación: investigación de laboratorio y análisis
Uso restringido: no apto para consumo humano; no apto para uso médico, veterinario o cosmético
Producido en instalaciones que cumplen con GMP bajo estrictos protocolos de control de calidad.
Cada lote se somete a pruebas de laboratorio exhaustivas después de la producción (puede encontrar el Certificado de Análisis debajo de las imágenes del producto).
Liofilizado (liofilizado) para máxima estabilidad y vida útil prolongada.
Sellado en viales estériles, listo para la reconstitución.
Pureza: ≥ 98% (HPLC)
Apariencia: polvo blanco liofilizado
Composition: Cagrilintide 5 mg + Semaglutide 5 mg
Molecular formula Cagrilintide / Semaglutide: C₁₉₄H₃₁₂N₅₄O₅₉ S₂ / C₁₈₇H₂₉₁N₄₅O₅₉
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4113.64
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Semaglutide: H-Aib-EGTFTSDVSSYLEGQAA-K(18Oct-γ-Glu-AEEA-AEEA)-EFIAWLVRGRG

Almacenamiento: los viales liofilizados sin abrir se almacenan mejor refrigerar a 2–8 °C, que es el método de almacenamiento confirmado por nuestro socio de fabricación y adecuado para hasta 24 meses. Se prefiere la refrigeración porque minimiza los ciclos innecesarios de congelación y descongelación durante la manipulación rutinaria. Si se requiere un almacenamiento a más largo plazo, los viales liofilizados sin abrir también pueden mantenerse congelados. Una vez reconstituidos, almacene siempre a 2–8 °C y no congele.

Estudios clave publicados

• Frias JP, et al. Efficacy and Safety of Co-administered Once-weekly Cagrilintide and Semaglutide in Adults with Type 2 Diabetes. The Lancet, 2023.

The landmark Phase II trial demonstrating greater weight reduction and improved glycaemic control with the combination compared with either peptide alone.

• Aroda VR, et al. Efficacy and Safety of Once-weekly Cagrilintide–Semaglutide in Adults with Type 2 Diabetes. The Lancet Diabetes & Endocrinology, 2025/2026.

A pivotal study supporting continued development of the fixed-dose combination and providing additional efficacy and safety data.

• Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021.

The foundational Phase II study establishing Cagrilintide as a leading long-acting amylin analogue.

• Wilding JPH, et al. Once-weekly Semaglutide in Adults with Overweight or Obesity. New England Journal of Medicine, 2021.

The landmark STEP-1 trial establishing Semaglutide as a cornerstone of modern obesity and metabolic research.

Preguntas Frecuentes

What is CagriSema Blend?

CagriSema Blend combines Cagrilintide (5 mg) and Semaglutide (5 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin and GLP-1 receptor signalling.

Which peptides are included in CagriSema?

Each vial contains:

• Cagrilintide – 5 mg
• Semaglutide – 5 mg

Together these peptides target two complementary hormonal systems involved in appetite regulation, satiety, gastric emptying and energy balance.

Why are Cagrilintide and Semaglutide combined?

Semaglutide activates the GLP-1 receptor, while Cagrilintide is a long-acting amylin analogue. Because they regulate metabolism through different physiological pathways, researchers investigate the combination to better understand complementary metabolic signalling. Unlike many peptide blends, this combination has been evaluated in dedicated human clinical trials.

What research areas commonly investigate CagriSema Blend?

Published research has investigated CagriSema in appetite regulation, satiety signalling, body-weight regulation, energy balance, gastric emptying, glycaemic control and complementary amylin–GLP-1 biology.

How does CagriSema differ from CagriTirz?

Both blends contain Cagrilintide, but CagriSema combines it with Semaglutide, while CagriTirz combines it with Tirzepatide. CagriTirz adds GIP receptor agonism, whereas CagriSema is currently supported by the most extensive dedicated clinical evidence for an amylin–GLP-1 combination.

Can research on CagriSema be applied directly to this blend?

Yes, unlike many research blends, CagriSema has been investigated as a fixed-dose combination in dedicated clinical studies. While this research relates to pharmaceutical formulations used in those trials rather than this specific product, it provides direct evidence for the biological combination of Cagrilintide and Semaglutide.

¿Está este producto destinado al uso humano?

No. CagriSema Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the scientific literature relating to the peptide combination rather than the intended use of this product.

Contexto de investigación relacionado

Cagrilintide / Semaglutide combines amylin analogue signaling with GLP-1 receptor activation, forming a dual-pathway metabolic research model.

For comparative frameworks, researchers may also examine:

Semaglutida — GLP-1 receptor agonist
Cagrilintida — amylin analogue
Tirzepatida — GLP-1/GIP dual agonist
Cagri-based blends — extended combination models

This combination is commonly positioned in research exploring satiety signaling alongside incretin-mediated metabolic regulation.

For additional context, see the Guía de investigación metabólica de GLP-1 and related compounds within the Metabolic research category.

NOTA: Esto es solo para fines de referencia educativa y no constituye asesoramiento médico.

Descargo de responsabilidad
Este producto se vende únicamente para fines de investigación. No está destinado a diagnosticar, tratar, curar ni prevenir ninguna enfermedad. El comprador asume toda la responsabilidad por su manipulación y uso adecuados.