Description
CagriSema Blend combines:
- Cagrilintide – 5 mg
- Semaglutide – 5 mg
Rather than representing a new peptide, CagriSema combines two well-characterised investigational compounds with complementary biological mechanisms.
Semaglutide is a GLP-1 receptor agonist, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate two hormonal pathways that regulate appetite, satiety, gastric emptying and energy balance through different physiological mechanisms.
Why CagriSema matters in metabolic research
Among all current metabolic peptide combinations, CagriSema has one of the strongest clinical evidence bases.
The individual components contribute complementary biology.
Semaglutide
- GLP-1 receptor agonism
- appetite regulation
- incretin signalling
- glucose homeostasis
- metabolic regulation
Cagrilintide
- amylin receptor signalling
- satiety biology
- gastric emptying
- appetite regulation
Because these pathways regulate food intake through different mechanisms, CagriSema has become one of the leading investigational combinations in obesity and metabolic research.
The two components of CagriSema
Semaglutide (5 mg)
A GLP-1 receptor agonist with an extensive clinical evidence base across obesity and metabolic research. Published studies have established Semaglutide as one of the foundational compounds in modern incretin biology.
Cagrilintide (5 mg)
A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it targets amylin receptors rather than GLP-1 receptors, it provides complementary metabolic signalling.
Why researchers combine Cagrilintide with Semaglutide
One of the major goals in metabolic research is to investigate whether targeting multiple hormonal pathways produces broader physiological effects than activating a single receptor system.
Semaglutide provides GLP-1 receptor agonism.
Cagrilintide provides amylin receptor signalling.
Unlike many experimental peptide blends, this combination has been evaluated in multiple human clinical studies, which demonstrated greater weight reduction than either Semaglutide or Cagrilintide alone while maintaining an acceptable tolerability profile. These findings have established CagriSema as one of the most extensively investigated combination therapies in metabolic research.
Human and preclinical research
CagriSema has one of the strongest evidence bases among investigational metabolic peptide combinations.
Published Phase II and Phase III studies have investigated the combination in adults with obesity and type 2 diabetes, reporting significant improvements in body weight and glycaemic control compared with the individual components. Ongoing REDEFINE and REIMAGINE clinical programmes continue to evaluate its long-term efficacy and safety.
Unlike many research blends, CagriSema is supported by dedicated combination trials rather than only by studies of its individual peptides.
How CagriSema differs from other metabolic blends
CagriSema
- Cagrilintide
- Semaglutide
- Amylin + GLP-1
- Most clinically investigated combination
CagriTirz
- Cagrilintide
- Tirzepatide
- Amylin + GLP-1 + GIP
- Emerging combination research
CagriReta
- Cagrilintide
- Retatrutide
- Amylin + GLP-1 + GIP + glucagon
- Next-generation experimental receptor profile
Researchers select between these formulations based on the metabolic pathways they wish to investigate and the available clinical evidence.
Published safety considerations
Published safety data for CagriSema primarily describe gastrointestinal adverse events, including nausea, vomiting, diarrhoea and decreased appetite, particularly during dose escalation. Across clinical studies, these events were generally mild to moderate and consistent with the known safety profiles of GLP-1 receptor agonists and amylin analogues.
Product characteristics
Application: laboratory and analytical research
Use restriction: not for human consumption; not for medical, veterinary or cosmetic use
Produced in GMP-compliant facilities under strict QC protocols.
Each batch carefully lab tested after production (you can find Certificate of Analysis under product pictures).
Freeze-dried (lyophilized) for maximum stability and extended shelf life.
Sealed in sterile vials, ready for reconstitution.
Purity: ≥ 98% (HPLC)
Appearance: white lyophilized powder
Composition: Cagrilintide 5 mg + Semaglutide 5 mg
Molecular formula Cagrilintide / Semaglutide: C194H312N54O59 S2 / C187H291N45O59
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4113.64
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Semaglutide: H-Aib-EGTFTSDVSSYLEGQAA-K(18Oct-γ-Glu-AEEA-AEEA)-EFIAWLVRGRG
Storage: unopened lyophilized vials are best stored refrigerated at 2–8°C, which is the storage method confirmed by our manufacturing partner and suitable for up to 24 months. Refrigeration is preferred because it minimizes unnecessary freeze–thaw cycles during routine handling. If substantially longer-term storage is required, unopened lyophilized vials may also be kept frozen. Once reconstituted, always store at 2–8°C and do not freeze.
Key published studies
- Frias JP, et al. Efficacy and Safety of Co-administered Once-weekly Cagrilintide and Semaglutide in Adults with Type 2 Diabetes. The Lancet, 2023.
The landmark Phase II trial demonstrating greater weight reduction and improved glycaemic control with the combination compared with either peptide alone.
- Aroda VR, et al. Efficacy and Safety of Once-weekly Cagrilintide–Semaglutide in Adults with Type 2 Diabetes. The Lancet Diabetes & Endocrinology, 2025/2026.
A pivotal study supporting continued development of the fixed-dose combination and providing additional efficacy and safety data.
- Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021.
The foundational Phase II study establishing Cagrilintide as a leading long-acting amylin analogue.
- Wilding JPH, et al. Once-weekly Semaglutide in Adults with Overweight or Obesity. New England Journal of Medicine, 2021.
The landmark STEP-1 trial establishing Semaglutide as a cornerstone of modern obesity and metabolic research.
Frequently Asked Questions
What is CagriSema Blend?
CagriSema Blend combines Cagrilintide (5 mg) and Semaglutide (5 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin and GLP-1 receptor signalling.
Which peptides are included in CagriSema?
Each vial contains:
- Cagrilintide – 5 mg
- Semaglutide – 5 mg
Together these peptides target two complementary hormonal systems involved in appetite regulation, satiety, gastric emptying and energy balance.
Why are Cagrilintide and Semaglutide combined?
Semaglutide activates the GLP-1 receptor, while Cagrilintide is a long-acting amylin analogue. Because they regulate metabolism through different physiological pathways, researchers investigate the combination to better understand complementary metabolic signalling. Unlike many peptide blends, this combination has been evaluated in dedicated human clinical trials.
What research areas commonly investigate CagriSema Blend?
Published research has investigated CagriSema in appetite regulation, satiety signalling, body-weight regulation, energy balance, gastric emptying, glycaemic control and complementary amylin–GLP-1 biology.
How does CagriSema differ from CagriTirz?
Both blends contain Cagrilintide, but CagriSema combines it with Semaglutide, while CagriTirz combines it with Tirzepatide. CagriTirz adds GIP receptor agonism, whereas CagriSema is currently supported by the most extensive dedicated clinical evidence for an amylin–GLP-1 combination.
Can research on CagriSema be applied directly to this blend?
Yes, unlike many research blends, CagriSema has been investigated as a fixed-dose combination in dedicated clinical studies. While this research relates to pharmaceutical formulations used in those trials rather than this specific product, it provides direct evidence for the biological combination of Cagrilintide and Semaglutide.
Is this product intended for human use?
No. CagriSema Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the scientific literature relating to the peptide combination rather than the intended use of this product.
Related research context
Cagrilintide / Semaglutide combines amylin analogue signaling with GLP-1 receptor activation, forming a dual-pathway metabolic research model.
For comparative frameworks, researchers may also examine:
Semaglutide — GLP-1 receptor agonist
Cagrilintide — amylin analogue
Tirzepatide — GLP-1/GIP dual agonist
Cagri-based blends — extended combination models
This combination is commonly positioned in research exploring satiety signaling alongside incretin-mediated metabolic regulation.
For additional context, see the GLP-1 metabolic research guide and related compounds within the Metabolic research category.
NOTE: This is for educational reference only and does not constitute medical advice.
Disclaimer
This product is sold for research purposes only. It is not intended to diagnose, treat, cure, or prevent any disease. Buyer assumes full responsibility for proper handling and use.









Reviews
There are no reviews yet.