X

Blend Cagrilintide 5 mg + Semaglutid 5 mg

120,00 

Cagrilintide / Semaglutide blend combining amylin and GLP-1 pathways for metabolic signaling research.

HPLC Purity ≥98% | Lyophilized | Research grade | EU-based supply | Free EU shipping over €100

Vorrätig

Beschreibung

Amylin + GLP-1 research blend

Cagrilintide / Semaglutide is a dual-pathway peptide blend investigated for its interaction with amylin receptor signaling and GLP-1–mediated incretin pathways in metabolic research models.
This combination enables the study of complementary mechanisms, integrating central satiety signaling with incretin-driven glucose and appetite regulation pathways. Compared to single-compound models, this blend provides a more layered framework for investigating metabolic signaling interactions.
Researchers often explore such combinations in models focused on appetite regulation, energy balance, and endocrine system coordination.

Research applications (investigational)

This combination has been explored in research settings for:

  • Amylin and GLP-1 pathway interaction
  • Satiety signaling and appetite regulation models
  • Gastric emptying and nutrient intake dynamics
  • Glucose metabolism and incretin response
  • Combination peptide research frameworks
  • Comparative studies vs standalone GLP-1 analogues

These areas reflect ongoing scientific investigation into complex metabolic signaling rather than established applications.

Product characteristics

Purity: ≥ 98% (HPLC)
Appearance: white lyophilized powder
Composition: Cagrilintide 5 mg + Semaglutide 5 mg
Molecular formula Cagrilintide / Semaglutide: C194H312N54O59 S2 / C187H291N45O59
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4113.64
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Semaglutide: H-Aib-EGTFTSDVSSYLEGQAA-K(18Oct-γ-Glu-AEEA-AEEA)-EFIAWLVRGRG
Storage: store lyophilized powder at -20°C, protect from light and moisture. Reconstituted solution should be kept at 2–8°C and used within a short period.

Why choose this blend

Complementary dual-pathway signaling model
≥ 98% purity verified by HPLC.
Produced in GMP-compliant facilities under strict QC protocols.
Each batch carefully lab tested after production (Certificate of Analysis available under product pictures).
Freeze-dried (lyophilized) for maximum stability and extended shelf life.
Sealed in sterile vials, ready for reconstitution.
Reconstitution: requires careful reconstitution with bacteriostatic water. Peptides in this class may dissolve gradually and should be handled gently to maintain solution clarity.

Selected research references

  • Lau J et al. Long-acting amylin analogues in metabolic research. Journal of Medicinal Chemistry, 2021.
  • Wilding JPH et al. GLP-1 receptor agonists in metabolic studies. New England Journal of Medicine, 2021.
  • Frias JP et al. Amylin-based combination strategies. The Lancet, 2021.
  • Knop FK et al. Incretin and amylin interaction frameworks. Nature Reviews Endocrinology, 2023.

Related research context

Cagrilintide / Semaglutide combines amylin analogue signaling with GLP-1 receptor activation, forming a dual-pathway metabolic research model.

For comparative frameworks, researchers may also examine:

Semaglutid — GLP-1 receptor agonist
Cagrilintid — amylin analogue
Tirzepatid — GLP-1/GIP dual agonist
Cagri-based blends — extended combination models

This combination is commonly positioned in research exploring satiety signaling alongside incretin-mediated metabolic regulation.

For additional context, see the GLP-1 metabolic research guide and related compounds within the Metabolic research category.

NOTE: This is for educational reference only and does not constitute medical advice.

Disclaimer
This product is sold for research purposes only. It is not intended to diagnose, treat, cure, or prevent any disease. Buyer assumes full responsibility for proper handling and use.

Rezensionen

Es gibt noch keine Rezensionen.

Schreibe die erste Rezension für „Blend Cagrilintide 5 mg + Semaglutide 5 mg“

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert

Ähnliche Produkte