X

Cagrilintid 5 mg

90,00 

Cagrilintide is a long-acting amylin analogue investigated for satiety signaling and appetite regulation pathways in metabolic research models.

  HPLC Purity ≥98% | Lyophilized | Research grade | EU-based supply | Free EU shipping over €100

Vorrätig

Beschreibung

Amylin analogue for metabolic signaling research

Cagrilintide is a long-acting amylin analogue investigated for its interaction with satiety signaling and energy balance pathways in metabolic research models. Unlike incretin-based compounds (GLP-1 or GIP agonists), cagrilintide targets amylin receptor pathways, offering a complementary mechanism within metabolic regulation studies.

In research settings, amylin analogues are explored for their role in appetite modulation, gastric emptying dynamics, and central satiety signaling. Cagrilintide is of particular interest due to its extended activity profile, making it suitable for sustained pathway investigation and combination models alongside incretin-based compounds.

Because of its distinct mechanism, cagrilintide is frequently studied both as a standalone compound and in combination frameworks (e.g., with GLP-1 receptor agonists) to examine multi-pathway metabolic signaling interactions. For broader context, see the GLP-1 metabolic research guide.

Research applications (investigational)

Cagrilintide has been investigated in experimental and preclinical settings for its involvement in:

  • Amylin receptor signaling and satiety pathway modulation
  • Appetite regulation and central nervous system signaling mechanisms
  • Gastric emptying and nutrient intake dynamics
  • Energy balance and weight regulation models
  • Combination peptide research (amylin + incretin pathways)
  • Multi-pathway metabolic signaling frameworks

These areas reflect ongoing scientific investigation into complex metabolic signaling rather than established applications.

Product characteristics

Purity: ≥ 98% (HPLC)
Appearance: white lyophilized powder
Molecular formula: C194H312N54O59 S2
Molecular weight: 4409.01
Sequence: {diacid-C20-γ-Glu}KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Storage: store lyophilized powder at -20°C, protect from light and moisture. Reconstituted solution should be kept at 2–8°C and used within a short period.

Why choose our Cagrilintide

≥ 98% purity verified by HPLC.
Produced in GMP-compliant facilities under strict QC protocols.
Each batch carefully lab tested after production (you can find Certificate of Analysis under product pictures).
Freeze-dried (lyophilized) for maximum stability and extended shelf life.
Sealed in sterile vials, ready for reconstitution.
Reconstitution: requires careful reconstitution with bacteriostatic water. Peptides in this class may dissolve gradually and should be handled gently to maintain solution clarity.

Selected research references

  • Lau J et al. Discovery of cagrilintide, a long-acting amylin analogue for metabolic research. Journal of Medicinal Chemistry, 2021
  • Frias JP et al. Amylin analogue cagrilintide in weight management research models. The Lancet, 2021
  • Overgaard RV et al. Pharmacokinetic and pharmacodynamic properties of cagrilintide. Clinical Pharmacokinetics, 2022
  • Knop FK et al. Amylin and combination peptide approaches in metabolic research. Nature Reviews Endocrinology, 2023
  • ClinicalTrials.gov — studies evaluating amylin analogues in metabolic research settings, 2019–2023.

Related research context

Cagrilintide belongs to the amylin analogue class within metabolic research.
For comparative frameworks:
• GLP-1 receptor agonists (e.g., Semaglutid)
• Dual agonists (e.g., Tirzepatid)
• Combination models (e.g., CagriSema research frameworks)
For broader mechanism comparison, see the GLP-1 metabolic research guide and explore the Metabolic research category for related compounds.

NOTE: This is for educational reference only and does not constitute medical advice.

Disclaimer
This product is sold for research purposes only. It is not intended to diagnose, treat, cure, or prevent any disease. Buyer assumes full responsibility for proper handling and use.

Rezensionen

Es gibt noch keine Rezensionen.

Schreibe die erste Rezension für „Cagrilintide 5 mg“

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert