X

Blend Cagrilintide 5 mg + Retatrutide 10 mg

170,00 

CagriReta Blend 15 mg is a research-grade metabolic peptide formulation combining Cagrilintide (5 mg) and Retatrutide (10 mg) in a single lyophilised vial. Designed for laboratory research, it brings together four complementary metabolic pathways by combining amylin signalling with GLP-1, GIP and glucagon receptor agonism.

Purity ≥98% | EU shipping from €5 | Free shipping upgrades available | Card payments accepted

En stock

Descripción

CagriReta Blend combines:

  • Cagrilintide – 5 mg
  • Retatrutide – 10 mg

Rather than representing a new peptide, CagriReta combines two investigational metabolic compounds with different biological targets.

Retatrutide is a triple receptor agonist acting on GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate four complementary metabolic signalling pathways within a single experimental formulation.


Why CagriReta matters in metabolic research

Modern obesity research increasingly focuses on engaging multiple hormonal pathways rather than relying on a single mechanism.

The two components of CagriReta investigate complementary biology:

Retatrutida

  • GLP-1 receptor agonism
  • GIP receptor agonism
  • agonismo del receptor de glucagón
  • energy expenditure
  • metabolic regulation

Cagrilintida

  • amylin receptor signalling
  • satiety biology
  • gastric emptying
  • appetite regulation

Together these pathways represent four distinct hormonal systems involved in metabolic regulation. However, current published evidence relates to the individual peptides, and dedicated studies evaluating the combined formulation are not yet available.

The two components of CagriReta

Retatrutide (10 mg)

A triple agonist investigated for simultaneous activation of GLP-1, GIP and glucagon receptors. Published clinical research has demonstrated substantial effects on body-weight regulation and metabolic outcomes, making it one of the most advanced next-generation incretin peptides under investigation.

Cagrilintide (5 mg)

A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it acts through amylin receptors rather than incretin receptors, it provides a complementary research pathway to GLP-1-based therapies.

Why researchers combine Cagrilintide with Retatrutide

One of the most active areas in metabolic research is combining peptides that target different physiological pathways rather than increasing activity at the same receptor.

Retatrutide already activates three metabolic receptors. Cagrilintide adds amylin signalling, a pathway not directly targeted by Retatrutide. This complementary receptor profile has made the combination increasingly popular in experimental metabolic research, although direct clinical evidence for the blend itself is currently unavailable.


Investigación humana y preclínica

At present there are no published Phase II or Phase III clinical trials evaluating the CagriReta combination.

Instead, the scientific rationale is based on:

  • extensive clinical investigation of Retatrutide
  • Phase II and Phase III development of Cagrilintide
  • successful investigation of amylin plus GLP-1 combinations such as CagriSema

For this reason, CagriReta should be regarded as a research blend built upon complementary metabolic mechanisms rather than as a formulation with its own clinical evidence base.

How CagriReta differs from other metabolic blends

CagriReta

  • Cagrilintida
  • Retatrutida
  • Four metabolic pathways
  • Amylin + GLP-1 + GIP + glucagon

CagriSema

  • Cagrilintida
  • Semaglutida
  • Amylin + GLP-1

CagriTirz

  • Cagrilintida
  • Tirzepatida
  • Amylin + GLP-1 + GIP

Each formulation investigates a different combination of metabolic signalling pathways rather than representing successive versions of the same concept.

Consideraciones de seguridad publicadas

Published safety information for CagriReta is derived from studies of Cagrilintide and Retatrutide individually. Both peptides have primarily been associated with gastrointestinal adverse events, including nausea, vomiting and diarrhoea during dose escalation in clinical studies. Because the combined formulation has not been evaluated in dedicated clinical trials, safety observations should be interpreted according to the literature available for each individual component.


Características del producto

Aplicación: investigación de laboratorio y análisis
Uso restringido: no apto para consumo humano; no apto para uso médico, veterinario o cosmético
Producido en instalaciones que cumplen con GMP bajo estrictos protocolos de control de calidad.
Cada lote se somete a pruebas de laboratorio exhaustivas después de la producción (puede encontrar el Certificado de Análisis debajo de las imágenes del producto).
Liofilizado (liofilizado) para máxima estabilidad y vida útil prolongada.
Sellado en viales estériles, listo para la reconstitución.
Pureza: ≥ 98% (HPLC)
Apariencia: polvo blanco liofilizado
Composition: Cagrilintide 5 mg + Retatrutide 10 mg
Molecular formula Cagrilintide / Retatrutide: C194H312N54O59 S2 / C221H342N46O68
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4731.4
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Retatrutide: Y{Aib}QGTFTSDYSI{α-Me-Leu}LDK-Lys{diacid-C20-γ-Glu-(AEEA)}-AQ{Aib}AFIEYLLEGGPSSGAPPPS-NH2

Almacenamiento: los viales liofilizados sin abrir se almacenan mejor refrigerar a 2–8 °C, que es el método de almacenamiento confirmado por nuestro socio de fabricación y adecuado para hasta 24 meses. Se prefiere la refrigeración porque minimiza los ciclos innecesarios de congelación y descongelación durante la manipulación rutinaria. Si se requiere un almacenamiento a más largo plazo, los viales liofilizados sin abrir también pueden mantenerse congelados. Una vez reconstituidos, almacene siempre a 2–8 °C y no congele.

Reconstitución y manipulación

CagriReta is supplied as a lyophilised vial and should be handled using standard peptide reconstitution procedures appropriate to the research setting. Must be reconstituted with agua bacteriostática antes de usar. Para ayudar a preservar la integridad estructural, agregue el disolvente elegido lentamente contra la pared interior del vial en lugar de directamente sobre el péptido en polvo, y evite agitar vigorosamente. La agitación suave suele ser suficiente una vez que el péptido se ha disuelto por completo. La práctica estándar de laboratorio también incluye permitir que los viales refrigerados alcancen la temperatura ambiente antes de la reconstitución para minimizar la condensación dentro del vial.

Para otras guías sobre selección de solventes, planificación de concentraciones y almacenamiento, consulte el completo Guía de Reconstitución de Péptidos y Calculadora de Reconstitución.


Estudios clave publicados

  • Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021

Landmark Phase II trial establishing Cagrilintide as a leading long-acting amylin analogue.

  • Jastreboff AM, et al. Agonista de receptores triples de hormonas, retatrutida, para la obesidad. New England Journal of Medicine, 2023

Pivotal Phase II trial demonstrating substantial weight reduction with triple receptor agonism.

  • D’Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity. Cardiology in Review, 2024

Comprehensive review of amylin biology and Cagrilintide development.

  • Katsi V, et al. Retatrutide: Un cambio de juego en la farmacoterapia de la obesidad. 2025

Review of Retatrutide pharmacology, receptor profile and clinical development.


Preguntas Frecuentes

What is CagriReta Blend?

CagriReta Blend combines Cagrilintide (5 mg) and Retatrutide (10 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin, GLP-1, GIP and glucagon signalling.

Which peptides are included in CagriReta?

Each vial contains:

  • Cagrilintide – 5 mg
  • Retatrutide – 10 mg

Together these peptides provide four complementary hormonal pathways commonly investigated in metabolic research.

Why are Cagrilintide and Retatrutide combined?

Retatrutide activates GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Because these peptides target different physiological systems, researchers investigate the combination to explore broader metabolic signalling than either compound alone. Current published evidence, however, relates to the individual peptides rather than to the blend itself.

What research areas commonly investigate CagriReta Blend?

Based on the published literature for its individual components, CagriReta is relevant to research involving appetite regulation, satiety signalling, energy balance, body-weight regulation, gastric emptying, incretin biology and amylin receptor signalling.

How does CagriReta differ from CagriSema?

Both blends contain Cagrilintide, but CagriSema combines it with Semaglutide, whereas CagriReta combines it with Retatrutide. Retatrutide adds GIP and glucagon receptor agonism in addition to GLP-1 activity, giving CagriReta a broader receptor profile for metabolic research.

Can research on Cagrilintide and Retatrutide be applied directly to the blend?

Not necessarily. Both peptides have substantial independent clinical literature, but there are currently no dedicated large clinical studies evaluating the CagriReta formulation. Findings should therefore be interpreted according to the evidence available for each individual component.

¿Está este producto destinado al uso humano?

No. CagriReta Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the scientific literature relating to the individual peptide components rather than the intended use of the combined formulation.


Contexto de investigación relacionado

Cagrilintide / Retatrutide represents an advanced multi-pathway research model combining amylin receptor signaling with triple-receptor incretin agonism (GLP-1, GIP, glucagon).
For structured comparison and deeper context, researchers may also examine:
Retatrutida — triple-receptor agonist (GLP-1/GIP/glucagon)
Cagrilintida — amylin analogue (satiety signaling pathway)
Tirzepatida — dual incretin agonist (GLP-1/GIP)
Semaglutida — GLP-1 receptor agonist
For broader mechanism comparison, see the Guía de investigación metabólica de GLP-1 and explore the Metabolic рesearch category.
This blend is most relevant in studies investigating layered hormonal signaling and multi-receptor metabolic interaction frameworks.

NOTA: Esto es solo para fines de referencia educativa y no constituye asesoramiento médico.

Descargo de responsabilidad
Este producto se vende únicamente para fines de investigación. No está destinado a diagnosticar, tratar, curar ni prevenir ninguna enfermedad. El comprador asume toda la responsabilidad por su manipulación y uso adecuados.

Valoraciones

No hay valoraciones aún.

Sé el primero en valorar “Blend Cagrilintide 5 mg + Retatrutide 10 mg”

Tu dirección de correo electrónico no será publicada. Los campos obligatorios están marcados con *

Productos relacionados