Descrizione
CagriReta Blend combines:
- Cagrilintide – 5 mg
- Retatrutide – 10 mg
Rather than representing a new peptide, CagriReta combines two investigational metabolic compounds with different biological targets.
Retatrutide is a triple receptor agonist acting on GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate four complementary metabolic signalling pathways within a single experimental formulation.
Why CagriReta matters in metabolic research
Modern obesity research increasingly focuses on engaging multiple hormonal pathways rather than relying on a single mechanism.
The two components of CagriReta investigate complementary biology:
Retatrutide
- GLP-1 receptor agonism
- GIP receptor agonism
- agonismo del recettore del glucagone
- energy expenditure
- metabolic regulation
Cagrilintide
- amylin receptor signalling
- satiety biology
- gastric emptying
- appetite regulation
Together these pathways represent four distinct hormonal systems involved in metabolic regulation. However, current published evidence relates to the individual peptides, and dedicated studies evaluating the combined formulation are not yet available.
The two components of CagriReta
Retatrutide (10 mg)
A triple agonist investigated for simultaneous activation of GLP-1, GIP and glucagon receptors. Published clinical research has demonstrated substantial effects on body-weight regulation and metabolic outcomes, making it one of the most advanced next-generation incretin peptides under investigation.
Cagrilintide (5 mg)
A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it acts through amylin receptors rather than incretin receptors, it provides a complementary research pathway to GLP-1-based therapies.
Why researchers combine Cagrilintide with Retatrutide
One of the most active areas in metabolic research is combining peptides that target different physiological pathways rather than increasing activity at the same receptor.
Retatrutide already activates three metabolic receptors. Cagrilintide adds amylin signalling, a pathway not directly targeted by Retatrutide. This complementary receptor profile has made the combination increasingly popular in experimental metabolic research, although direct clinical evidence for the blend itself is currently unavailable.
Ricerca umana e preclinica
At present there are no published Phase II or Phase III clinical trials evaluating the CagriReta combination.
Instead, the scientific rationale is based on:
- extensive clinical investigation of Retatrutide
- Phase II and Phase III development of Cagrilintide
- successful investigation of amylin plus GLP-1 combinations such as CagriSema
For this reason, CagriReta should be regarded as a research blend built upon complementary metabolic mechanisms rather than as a formulation with its own clinical evidence base.
How CagriReta differs from other metabolic blends
CagriReta
- Cagrilintide
- Retatrutide
- Four metabolic pathways
- Amylin + GLP-1 + GIP + glucagon
CagriSema
- Cagrilintide
- Semaglutide
- Amylin + GLP-1
CagriTirz
- Cagrilintide
- Tirzepatide
- Amylin + GLP-1 + GIP
Each formulation investigates a different combination of metabolic signalling pathways rather than representing successive versions of the same concept.
Published safety considerations
Published safety information for CagriReta is derived from studies of Cagrilintide and Retatrutide individually. Both peptides have primarily been associated with gastrointestinal adverse events, including nausea, vomiting and diarrhoea during dose escalation in clinical studies. Because the combined formulation has not been evaluated in dedicated clinical trials, safety observations should be interpreted according to the literature available for each individual component.
Caratteristiche del prodotto
Applicazione: ricerca di laboratorio e analitica
Uso limitato: non per il consumo umano; non per uso medico, veterinario o cosmetico
Prodotto in stabilimenti conformi alle GMP secondo rigidi protocolli di controllo qualità.
Ogni lotto viene accuratamente testato in laboratorio dopo la produzione (puoi trovare il Certificato di Analisi sotto le immagini del prodotto).
Liofilizzato (liofilizzato) per la massima stabilità e una lunga durata di conservazione.
Sigillato in fiale sterili, pronto per la ricostituzione.
Purezza: ≥ 98% (HPLC)
Aspetto: polvere liofilizzata bianca
Composition: Cagrilintide 5 mg + Retatrutide 10 mg
Molecular formula Cagrilintide / Retatrutide: C194H312N54O59 S2 / C221H342N46O68
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4731.4
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Retatrutide: Y{Aib}QGTFTSDYSI{α-Me-Leu}LDK-Lys{diacid-C20-γ-Glu-(AEEA)}-AQ{Aib}AFIEYLLEGGPSSGAPPPS-NH2
Archiviazioneflaconcini liofilizzati non aperti sono meglio conservati refrigerato a 2–8°C, che è il metodo di conservazione confermato dal nostro partner di produzione e adatto fino a 24 mesi. Si preferisce la refrigerazione perché minimizza inutili cicli di congelamento-scongelamento durante la manipolazione di routine. Se è necessaria una conservazione a termine sostanzialmente più lungo, i flaconcini liofilizzati non aperti possono anche essere conservati congelati. Una volta ricostituita, conservare sempre a 2-8°C e non congelare.
Ricostituzione e manipolazione
CagriReta is supplied as a lyophilised vial and should be handled using standard peptide reconstitution procedures appropriate to the research setting. Must be reconstituted with acqua batteriostatica prima dell'uso. Per aiutare a preservare l'integrità strutturale, aggiungere il solvente scelto lentamente contro la parete interna del flaconcino piuttosto che direttamente sulla polvere del peptide, ed evitare agitazioni vigorose. Il delicato movimento rotatorio è generalmente sufficiente una volta che il peptide si è completamente sciolto. La pratica standard di laboratorio include anche il far raggiungere ai flaconcini refrigerati la temperatura ambiente prima della ricostituzione per minimizzare la condensa all'interno del flaconcino.
Per altre indicazioni sulla scelta del solvente, sulla pianificazione della concentrazione e sullo stoccaggio, consultare il pieno Guida alla Ricostituzione dei Peptidi e Calcolatore di Ricostituzione.
Studi chiave pubblicati
- Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021
Landmark Phase II trial establishing Cagrilintide as a leading long-acting amylin analogue.
- Jastreboff AM, et al. Agonista del Triplo Ormone Retatrutide per l'Obesità. New England Journal of Medicine, 2023
Pivotal Phase II trial demonstrating substantial weight reduction with triple receptor agonism.
- D’Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity. Cardiology in Review, 2024
Comprehensive review of amylin biology and Cagrilintide development.
- Katsi V, et al. Retatrutide: Una svolta nella farmacoterapia per l'obesità. 2025
Review of Retatrutide pharmacology, receptor profile and clinical development.
Domande Frequenti
What is CagriReta Blend?
CagriReta Blend combines Cagrilintide (5 mg) and Retatrutide (10 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin, GLP-1, GIP and glucagon signalling.
Which peptides are included in CagriReta?
Each vial contains:
- Cagrilintide – 5 mg
- Retatrutide – 10 mg
Together these peptides provide four complementary hormonal pathways commonly investigated in metabolic research.
Why are Cagrilintide and Retatrutide combined?
Retatrutide activates GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Because these peptides target different physiological systems, researchers investigate the combination to explore broader metabolic signalling than either compound alone. Current published evidence, however, relates to the individual peptides rather than to the blend itself.
What research areas commonly investigate CagriReta Blend?
Based on the published literature for its individual components, CagriReta is relevant to research involving appetite regulation, satiety signalling, energy balance, body-weight regulation, gastric emptying, incretin biology and amylin receptor signalling.
How does CagriReta differ from CagriSema?
Both blends contain Cagrilintide, but CagriSema combines it with Semaglutide, whereas CagriReta combines it with Retatrutide. Retatrutide adds GIP and glucagon receptor agonism in addition to GLP-1 activity, giving CagriReta a broader receptor profile for metabolic research.
Can research on Cagrilintide and Retatrutide be applied directly to the blend?
Not necessarily. Both peptides have substantial independent clinical literature, but there are currently no dedicated large clinical studies evaluating the CagriReta formulation. Findings should therefore be interpreted according to the evidence available for each individual component.
Questo prodotto è destinato all'uso umano?
No. CagriReta Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the scientific literature relating to the individual peptide components rather than the intended use of the combined formulation.
Contesto di ricerca correlato
Cagrilintide / Retatrutide represents an advanced multi-pathway research model combining amylin receptor signaling with triple-receptor incretin agonism (GLP-1, GIP, glucagon).
For structured comparison and deeper context, researchers may also examine:
• Retatrutide — triple-receptor agonist (GLP-1/GIP/glucagon)
• Cagrilintide — amylin analogue (satiety signaling pathway)
• Tirzepatide — dual incretin agonist (GLP-1/GIP)
• Semaglutide — GLP-1 receptor agonist
For broader mechanism comparison, see the Guida alla ricerca metabolica sui GLP-1 and explore the Metabolic рesearch category.
This blend is most relevant in studies investigating layered hormonal signaling and multi-receptor metabolic interaction frameworks.
NOTA: Questo è solo a scopo didattico e non costituisce parere medico.
Disclaimer
Questo prodotto è venduto esclusivamente a scopo di ricerca. Non è destinato a diagnosticare, trattare, curare o prevenire alcuna malattia. L'acquirente si assume la piena responsabilità per la corretta manipolazione e utilizzo.









Recensioni
Ancora non ci sono recensioni.