Blend Cagrilintide 5 mg + Retatrutide 10 mg

Description

Multi-pathway metabolic research blend

Cagrilintide / Retatrutide is a combination peptide blend investigated for its interaction with complementary metabolic signaling pathways, integrating amylin receptor activity with multi-receptor incretin agonism (GLP-1, GIP, glucagon).

This blend is of particular interest in advanced metabolic research models exploring the combined effects of satiety signaling, energy expenditure modulation, and multi-pathway endocrine interaction. By pairing an amylin analogue with a triple-receptor agonist, this combination enables investigation into broader metabolic regulation frameworks compared to single- or dual-pathway compounds.

Researchers studying complex energy balance systems and multi-hormonal signaling interactions often examine such combinations for their ability to model layered physiological responses. For foundational context, see the GLP-1 metabolic research guide.

Research applications (investigational)

This combination has been explored in research settings for:

• Integrated amylin and incretin receptor signaling
• Multi-pathway appetite and satiety regulation models
• Energy expenditure and metabolic rate interaction studies
• Glucose regulation across combined hormonal pathways
• Advanced endocrine system modeling (triple + amylin interaction)
• Comparative analysis vs single and dual agonist systems

These areas reflect ongoing scientific investigation into complex metabolic signaling rather than established applications.

Product characteristics

Purity: ≥ 98% (HPLC)
Appearance: white lyophilized powder
Composition: Cagrilintide 5 mg + Retatrutide 10 mg
Molecular formula Cagrilintide / Retatrutide: C₁₉₄H₃₁₂N₅₄O₅₉ S₂ / C₂₂₁H₃₄₂N₄₆O₆₈
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4731.4
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Retatrutide: Y{Aib}QGTFTSDYSI{α-Me-Leu}LDK-Lys{diacid-C20-γ-Glu-(AEEA)}-AQ{Aib}AFIEYLLEGGPSSGAPPPS-NH2
Storage: store lyophilized powder at -20°C, protect from light and moisture. Reconstituted solution should be kept at 2–8°C and used within a short period.

Why choose this blend

Multi-pathway research model (amylin + GLP-1/GIP/glucagon)
≥ 98% purity verified by HPLC.
Produced in GMP-compliant facilities under strict QC protocols.
Each batch carefully lab tested after production (Certificate of Analysis available under product pictures).
Freeze-dried (lyophilized) for maximum stability and extended shelf life.
Sealed in sterile vials, ready for reconstitution.
Reconstitution: requires careful reconstitution with bacteriostatic water. Peptides in this class may dissolve gradually and should be handled gently to maintain solution clarity.

Selected research references

• Lau J et al. Amylin analogue development and metabolic signaling research. Journal of Medicinal Chemistry, 2021.
• Jastreboff AM et al. Triple-receptor agonism in metabolic research. New England Journal of Medicine, 2023.
• Rosenstock J et al. Multi-pathway incretin-based research models. The Lancet, 2023.
• Knop FK et al. Hormonal synergy in metabolic regulation. Nature Reviews Endocrinology, 2023.

Related research context

Cagrilintide / Retatrutide represents an advanced multi-pathway research model combining amylin receptor signaling with triple-receptor incretin agonism (GLP-1, GIP, glucagon).
For structured comparison and deeper context, researchers may also examine:
• Retatrutide — triple-receptor agonist (GLP-1/GIP/glucagon)
• Cagrilintide — amylin analogue (satiety signaling pathway)
• Tirzepatide — dual incretin agonist (GLP-1/GIP)
• Semaglutide — GLP-1 receptor agonist
For broader mechanism comparison, see the GLP-1 metabolic research guide and explore the Metabolic рesearch category.
This blend is most relevant in studies investigating layered hormonal signaling and multi-receptor metabolic interaction frameworks.

NOTE: This is for educational reference only and does not constitute medical advice.

Disclaimer
This product is sold for research purposes only. It is not intended to diagnose, treat, cure, or prevent any disease. Buyer assumes full responsibility for proper handling and use.