X

Μείγμα Καγριλιντίδης 5 mg + Ρετατρουτίδης 10 mg

170,00 

CagriReta Blend 15 mg is a research-grade metabolic peptide formulation combining Cagrilintide (5 mg) and Retatrutide (10 mg) in a single lyophilised vial. Designed for laboratory research, it brings together four complementary metabolic pathways by combining amylin signalling with GLP-1, GIP and glucagon receptor agonism.

Purity ≥98% | EU shipping from €5 | Free shipping upgrades available | Card payments accepted

Σε απόθεμα

Περιγραφή

CagriReta Blend combines:

  • Cagrilintide – 5 mg
  • Retatrutide – 10 mg

Rather than representing a new peptide, CagriReta combines two investigational metabolic compounds with different biological targets.

Retatrutide is a triple receptor agonist acting on GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate four complementary metabolic signalling pathways within a single experimental formulation.


Why CagriReta matters in metabolic research

Modern obesity research increasingly focuses on engaging multiple hormonal pathways rather than relying on a single mechanism.

The two components of CagriReta investigate complementary biology:

Ρετατρουτίδη

  • GLP-1 receptor agonism
  • GIP receptor agonism
  • αγωνισμός υποδοχέα γλυκαγόνης
  • energy expenditure
  • metabolic regulation

Καγκριλιντίδη

  • amylin receptor signalling
  • satiety biology
  • gastric emptying
  • appetite regulation

Together these pathways represent four distinct hormonal systems involved in metabolic regulation. However, current published evidence relates to the individual peptides, and dedicated studies evaluating the combined formulation are not yet available.

The two components of CagriReta

Retatrutide (10 mg)

A triple agonist investigated for simultaneous activation of GLP-1, GIP and glucagon receptors. Published clinical research has demonstrated substantial effects on body-weight regulation and metabolic outcomes, making it one of the most advanced next-generation incretin peptides under investigation.

Cagrilintide (5 mg)

A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it acts through amylin receptors rather than incretin receptors, it provides a complementary research pathway to GLP-1-based therapies.

Why researchers combine Cagrilintide with Retatrutide

One of the most active areas in metabolic research is combining peptides that target different physiological pathways rather than increasing activity at the same receptor.

Retatrutide already activates three metabolic receptors. Cagrilintide adds amylin signalling, a pathway not directly targeted by Retatrutide. This complementary receptor profile has made the combination increasingly popular in experimental metabolic research, although direct clinical evidence for the blend itself is currently unavailable.


Ανθρώπινη και προκλινική έρευνα

At present there are no published Phase II or Phase III clinical trials evaluating the CagriReta combination.

Instead, the scientific rationale is based on:

  • extensive clinical investigation of Retatrutide
  • Phase II and Phase III development of Cagrilintide
  • successful investigation of amylin plus GLP-1 combinations such as CagriSema

For this reason, CagriReta should be regarded as a research blend built upon complementary metabolic mechanisms rather than as a formulation with its own clinical evidence base.

How CagriReta differs from other metabolic blends

CagriReta

  • Καγκριλιντίδη
  • Ρετατρουτίδη
  • Four metabolic pathways
  • Amylin + GLP-1 + GIP + glucagon

CagriSema

  • Καγκριλιντίδη
  • Semaglutide
  • Amylin + GLP-1

CagriTirz

  • Καγκριλιντίδη
  • Τιρζεπατίδη
  • Amylin + GLP-1 + GIP

Each formulation investigates a different combination of metabolic signalling pathways rather than representing successive versions of the same concept.

Published safety considerations

Published safety information for CagriReta is derived from studies of Cagrilintide and Retatrutide individually. Both peptides have primarily been associated with gastrointestinal adverse events, including nausea, vomiting and diarrhoea during dose escalation in clinical studies. Because the combined formulation has not been evaluated in dedicated clinical trials, safety observations should be interpreted according to the literature available for each individual component.


Χαρακτηριστικά προϊόντος

Εφαρμογή: εργαστηριακή και αναλυτική έρευνα
Χρήση περιορισμού: όχι για ανθρώπινη κατανάλωση· όχι για ιατρική, κτηνιατρική ή καλλυντική χρήση
Παράγεται σε εγκαταστάσεις που συμμορφώνονται με τις ΟGMP υπό αυστηρά πρωτόκολλα ΠΚ.
Κάθε παρτίδα ελέγχεται προσεκτικά στο εργαστήριο μετά την παραγωγή (μπορείτε να βρείτε το Πιστοποιητικό Ανάλυσης κάτω από τις εικόνες του προϊόντος).
Κατάψυξη-αποξήρανση (λυσόφιλη) για μέγιστη σταθερότητα και παρατεταμένη διάρκεια ζωής.
Σφραγισμένα σε αποστειρωμένες φιάλες, έτοιμα για ανασύσταση.
Καθαρότητα: ≥ 98% (HPLC)
Εμφάνιση: λευκή λυοφιλοποιημένη σκόνη
Composition: Cagrilintide 5 mg + Retatrutide 10 mg
Molecular formula Cagrilintide / Retatrutide: C194H312N54O59 S2 / C221H342N46O68
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4731.4
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Retatrutide: Y{Aib}QGTFTSDYSI{α-Me-Leu}LDK-Lys{diacid-C20-γ-Glu-(AEEA)}-AQ{Aib}AFIEYLLEGGPSSGAPPPS-NH2

Αποθήκευση: τα αφυδατωμένα σε ξηρή ψύξη, σφραγισμένα φιαλίδια φυλάσσονται καλύτερα συντήρηση στους 2–8°C, η οποία είναι η μέθοδος αποθήκευσης που επιβεβαιώθηκε από τον συνεργάτη παραγωγής μας και είναι κατάλληλη για έως και 24 μήνες. Η ψύξη προτιμάται επειδή ελαχιστοποιεί τους περιττούς κύκλους ψύξης-απόψυξης κατά τον συνήθη χειρισμό. Εάν απαιτείται σημαντικά μακροχρόνια αποθήκευση, τα σφραγισμένα λυοφιλοποιημένα φιαλίδια μπορούν επίσης να διατηρηθούν κατεψυγμένα. Μόλις ανασυσταθεί, αποθηκεύετε πάντα σε 2–8°C και μην καταψύχετε.

Ανα

CagriReta is supplied as a lyophilised vial and should be handled using standard peptide reconstitution procedures appropriate to the research setting. Must be reconstituted with Βακτηριοστατικό νερό πριν τη χρήση. Για να διατηρηθεί η δομική ακεραιότητα, προσθέστε το επιλεγμένο διαλύτη αργά στο εσωτερικό τοίχωμα του φιαλιδίου αντί απευθείας στη μάζα του πεπτιδίου, και αποφύγετε το έντονο ανακίνημα. Η απαλή περιστροφή είναι γενικά επαρκής μόλις το πεπτίδιο διαλυθεί πλήρως. Η τυπική εργαστηριακή πρακτική περιλαμβάνει επίσης την αναμονή των ψυχόμενων φιαλιδίων να φτάσουν σε θερμοκρασία δωματίου πριν από την ανασύσταση για να ελαχιστοποιηθεί η συμπύκνωση στο εσωτερικό του φιαλιδίου.

Για την επιλογή άλλων διαλυτών, σχεδιασμό συγκεντρώσεων και οδηγίες αποθήκευσης, δείτε το πλήρες Οδηγός Ανασύστασης Πεπτιδίων και Υπολογιστής Απεικόνισης.


Βασικές δημοσιευμένες μελέτες

  • Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021

Landmark Phase II trial establishing Cagrilintide as a leading long-acting amylin analogue.

  • Jastreboff AM, et al. Τριπλο-αγωνιστής ορμονικών υποδοχέων ρετατρουτίδη για την παχυσαρκία. New England Journal of Medicine, 2023

Pivotal Phase II trial demonstrating substantial weight reduction with triple receptor agonism.

  • D’Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity. Cardiology in Review, 2024

Comprehensive review of amylin biology and Cagrilintide development.

  • Katsi V, et al. Ρετατρουτίδη—Ένας Παράγοντας Αλλαγής στο Φαρμακευτικό Φαινόμενο της Παχυσαρκίας. 2025

Review of Retatrutide pharmacology, receptor profile and clinical development.


Συχνές Ερωτήσεις

What is CagriReta Blend?

CagriReta Blend combines Cagrilintide (5 mg) and Retatrutide (10 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin, GLP-1, GIP and glucagon signalling.

Which peptides are included in CagriReta?

Each vial contains:

  • Cagrilintide – 5 mg
  • Retatrutide – 10 mg

Together these peptides provide four complementary hormonal pathways commonly investigated in metabolic research.

Why are Cagrilintide and Retatrutide combined?

Retatrutide activates GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Because these peptides target different physiological systems, researchers investigate the combination to explore broader metabolic signalling than either compound alone. Current published evidence, however, relates to the individual peptides rather than to the blend itself.

What research areas commonly investigate CagriReta Blend?

Based on the published literature for its individual components, CagriReta is relevant to research involving appetite regulation, satiety signalling, energy balance, body-weight regulation, gastric emptying, incretin biology and amylin receptor signalling.

How does CagriReta differ from CagriSema?

Both blends contain Cagrilintide, but CagriSema combines it with Semaglutide, whereas CagriReta combines it with Retatrutide. Retatrutide adds GIP and glucagon receptor agonism in addition to GLP-1 activity, giving CagriReta a broader receptor profile for metabolic research.

Can research on Cagrilintide and Retatrutide be applied directly to the blend?

Not necessarily. Both peptides have substantial independent clinical literature, but there are currently no dedicated large clinical studies evaluating the CagriReta formulation. Findings should therefore be interpreted according to the evidence available for each individual component.

Αυτό το προϊόν προορίζεται για ανθρώπινη χρήση;

No. CagriReta Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the scientific literature relating to the individual peptide components rather than the intended use of the combined formulation.


Σχετικό ερευνητικό πλαίσιο

Cagrilintide / Retatrutide represents an advanced multi-pathway research model combining amylin receptor signaling with triple-receptor incretin agonism (GLP-1, GIP, glucagon).
For structured comparison and deeper context, researchers may also examine:
Ρετατρουτίδη — triple-receptor agonist (GLP-1/GIP/glucagon)
Καγκριλιντίδη — amylin analogue (satiety signaling pathway)
Τιρζεπατίδη — dual incretin agonist (GLP-1/GIP)
Semaglutide — GLP-1 receptor agonist
For broader mechanism comparison, see the Οδηγός μεταβολικής έρευνας GLP-1 and explore the Metabolic рesearch category.
This blend is most relevant in studies investigating layered hormonal signaling and multi-receptor metabolic interaction frameworks.

ΣΗΜΕΙΩΣΗ: Αυτό είναι μόνο για εκπαιδευτική αναφορά και δεν αποτελεί ιατρική συμβουλή.

Αποποίηση ευθύνης
Αυτό το προϊόν πωλείται αποκλειστικά για ερευνητικούς σκοπούς. Δεν προορίζεται για τη διάγνωση, θεραπεία, ίαση ή πρόληψη οποιασδήποτε ασθένειας. Ο αγοραστής αναλαμβάνει πλήρως την ευθύνη για τον σωστό χειρισμό και τη χρήση.

Reviews

There are no reviews yet.

Be the first to review “Blend Cagrilintide 5 mg + Retatrutide 10 mg”

Η ηλ. διεύθυνση σας δεν δημοσιεύεται. Τα υποχρεωτικά πεδία σημειώνονται με *

Σχετικά προϊόντα