Descrizione
CagriTirz Blend combines:
- Cagrilintide – 5 mg
- Tirzepatide – 10 mg
Rather than representing a novel peptide, CagriTirz combines two investigational metabolic compounds with complementary mechanisms. Tirzepatide is a dual GLP-1/GIP receptor agonist, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate three major hormonal pathways involved in appetite regulation, satiety and metabolic homeostasis.
Why CagriTirz matters in metabolic research
Modern obesity research increasingly investigates therapies that target multiple hormonal pathways simultaneously.
The components of CagriTirz contribute different biological mechanisms.
Tirzepatide
- GLP-1 receptor agonism
- GIP receptor agonism
- incretin biology
- metabolic regulation
- glucose homeostasis
Cagrilintide
- amylin receptor signalling
- satiety biology
- gastric emptying
- appetite regulation
Together they represent three complementary endocrine pathways that regulate food intake and energy balance.
Unlike some experimental blends, this combination already has encouraging preclinical combination data, although dedicated human clinical trials of the formulation itself are not yet available.
The two components of CagriTirz
Tirzepatide (10 mg)
A dual GLP-1/GIP receptor agonist investigated extensively in obesity and metabolic research. Clinical studies have established Tirzepatide as one of the most important next-generation incretin peptides for body-weight regulation and glycaemic control.
Cagrilintide (5 mg)
A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it acts independently of incretin receptors, it complements GLP-1/GIP biology rather than duplicating it.
Why researchers combine Cagrilintide with Tirzepatide
One of the major goals in metabolic research is to activate different hormonal systems that regulate food intake.
Tirzepatide targets GLP-1 and GIP receptors.
Cagrilintide targets amylin receptors.
This complementary receptor profile has made the combination increasingly attractive in experimental metabolic research. Recent preclinical studies have reported greater reductions in food intake and body weight than either peptide alone, supporting continued investigation of this combination. These findings should be interpreted as early-stage research and not as evidence of clinical efficacy for the blend.
Ricerca umana e preclinica
There are currently no large Phase II or Phase III clinical trials evaluating the complete CagriTirz formulation.
However, the scientific rationale is supported by:
- extensive Phase III clinical research on Tirzepatide
- Phase II clinical development of Cagrilintide
- published preclinical studies evaluating the combination
- broader evidence supporting complementary amylin and incretin biology
Accordingly, CagriTirz should be viewed as a research formulation built from individually investigated peptides with emerging combination evidence rather than as a clinically validated blend.
How CagriTirz differs from other metabolic blends
CagriTirz
- Cagrilintide
- Tirzepatide
- Three metabolic pathways
- Amylin + GLP-1 + GIP
CagriSema
- Cagrilintide
- Semaglutide
- Amylin + GLP-1
CagriReta
- Cagrilintide
- Retatrutide
- Amylin + GLP-1 + GIP + glucagon
CagriTirz occupies the middle of the spectrum, combining dual incretin biology with amylin signalling while avoiding glucagon receptor agonism.
Published safety considerations
Published safety information for CagriTirz is derived from studies of Cagrilintide and Tirzepatide individually.
Both peptides have primarily been associated with gastrointestinal adverse events such as nausea, vomiting, diarrhoea and decreased appetite during dose escalation. Because dedicated clinical trials of the combined formulation are not yet available, current safety understanding should be based on the evidence for each component separately.
Caratteristiche del prodotto
Applicazione: ricerca di laboratorio e analitica
Uso limitato: non per il consumo umano; non per uso medico, veterinario o cosmetico
Prodotto in stabilimenti conformi alle GMP secondo rigidi protocolli di controllo qualità.
Ogni lotto viene accuratamente testato in laboratorio dopo la produzione (puoi trovare il Certificato di Analisi sotto le immagini del prodotto).
Liofilizzato (liofilizzato) per la massima stabilità e una lunga durata di conservazione.
Sigillato in fiale sterili, pronto per la ricostituzione.
Purezza: ≥ 98% (HPLC)
Aspetto: polvere liofilizzata bianca
Composition: Cagrilintide 5 mg + Tirzepatide 10 mg
Molecular formula Cagrilintide / Tirzepatide: C194H312N54O59 S2 / C225H348N48O59
Molecular weight Cagrilintide / Tirzepatide: 4409.01 / 4813.45
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Tirzepatide: Y{Aib}EGTFTSDYSI{Aib}LDKIAQ-K{diacid-C20-γ-Glu-(AEEA)2}-AFVQWLIAGGPSSGAPPPS-NH2
Archiviazioneflaconcini liofilizzati non aperti sono meglio conservati refrigerato a 2–8°C, che è il metodo di conservazione confermato dal nostro partner di produzione e adatto fino a 24 mesi. Si preferisce la refrigerazione perché minimizza inutili cicli di congelamento-scongelamento durante la manipolazione di routine. Se è necessaria una conservazione a termine sostanzialmente più lungo, i flaconcini liofilizzati non aperti possono anche essere conservati congelati. Una volta ricostituita, conservare sempre a 2-8°C e non congelare.
Ricostituzione e manipolazione
CagriTirz is supplied as a lyophilised vial and should be handled using standard peptide reconstitution procedures appropriate to the research setting. Must be reconstituted with acqua batteriostatica prima dell'uso. Per aiutare a preservare l'integrità strutturale, aggiungere il solvente scelto lentamente contro la parete interna del flaconcino piuttosto che direttamente sulla polvere del peptide, ed evitare agitazioni vigorose. Il delicato movimento rotatorio è generalmente sufficiente una volta che il peptide si è completamente sciolto. La pratica standard di laboratorio include anche il far raggiungere ai flaconcini refrigerati la temperatura ambiente prima della ricostituzione per minimizzare la condensa all'interno del flaconcino.
Per altre indicazioni sulla scelta del solvente, sulla pianificazione della concentrazione e sullo stoccaggio, consultare il pieno Guida alla Ricostituzione dei Peptidi e Calcolatore di Ricostituzione.
Studi chiave pubblicati
- Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021.
The landmark Phase II trial establishing Cagrilintide as a leading long-acting amylin analogue.
- Jastreboff AM, et al. Tirzepatide Once Weekly for the Treatment of Obesity. New England Journal of Medicine, 2022.
The pivotal Phase III SURMOUNT-1 trial establishing Tirzepatide as one of the leading dual incretin therapies for obesity research.
- Valdecantos P, et al. Beneficial Effect of the Combination Therapy of Cagrilintide and Tirzepatide. Diabetes, 2024.
Preclinical research demonstrating greater reductions in food intake and body weight with the combination than with either peptide alone, supporting further investigation of combined amylin and incretin signalling.
- D’Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity. Cardiology in Review, 2024.
A comprehensive review of amylin biology, Cagrilintide pharmacology and its role in next-generation metabolic therapies.
Domande Frequenti
What is CagriTirz Blend?
CagriTirz Blend combines Cagrilintide (5 mg) and Tirzepatide (10 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin, GLP-1 and GIP signalling.
Which peptides are included in CagriTirz?
Each vial contains:
- Cagrilintide – 5 mg
- Tirzepatide – 10 mg
Together these peptides provide three complementary hormonal pathways commonly investigated in appetite regulation, satiety and metabolic research.
Why are Cagrilintide and Tirzepatide combined?
Tirzepatide activates GLP-1 and GIP receptors, while Cagrilintide is a long-acting amylin analogue. Because they target different physiological systems, researchers investigate the combination to better understand complementary metabolic signalling. Experimental preclinical studies have also explored this combination, although dedicated human clinical trials are not yet available.
What research areas commonly investigate CagriTirz Blend?
Based on the published literature for its individual components, CagriTirz is relevant to research involving appetite regulation, satiety signalling, body-weight regulation, energy balance, gastric emptying, incretin biology and amylin receptor signalling.
How does CagriTirz differ from CagriReta?
Both blends contain Cagrilintide, but CagriTirz combines it with Tirzepatide, providing amylin, GLP-1 and GIP receptor activity. CagriReta combines Cagrilintide with Retatrutide, adding glucagon receptor agonism and expanding the receptor profile to four metabolic pathways.
Can research on Cagrilintide and Tirzepatide be applied directly to the blend?
Not completely. Both peptides have substantial independent clinical literature, and encouraging preclinical studies have investigated the combination. However, there are currently no large clinical trials evaluating the CagriTirz formulation itself, so findings should be interpreted within that context.
Questo prodotto è destinato all'uso umano?
No. CagriTirz Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the current scientific literature relating to the individual peptide components rather than the intended use of the combined formulation.
Contesto di ricerca correlato
Cagrilintide / Tirzepatide integrates amylin receptor signaling with dual incretin agonism (GLP-1 and GIP), forming a multi-hormonal metabolic research framework.
Researchers comparing signaling depth across compounds may also examine:
Tirzepatide — dual incretin agonist (GLP-1/GIP)
Cagrilintide — amylin analogue
Retatrutide — triple-receptor agonist
Semaglutide — single-pathway GLP-1 agonist
This blend is particularly relevant in studies focused on multi-layered endocrine signaling and combined satiety + incretin pathway interaction.
For additional context, see the Guida alla ricerca metabolica sui GLP-1 and related compounds within the Ricerca metabolica.
NOTA: Questo è solo a scopo didattico e non costituisce parere medico.
Disclaimer
Questo prodotto è venduto esclusivamente a scopo di ricerca. Non è destinato a diagnosticare, trattare, curare o prevenire alcuna malattia. L'acquirente si assume la piena responsabilità per la corretta manipolazione e utilizzo.









Reviews
There are no reviews yet.