Description
CagriReta Blend combines:
- Cagrilintide – 5 mg
- Retatrutide – 10 mg
Rather than representing a new peptide, CagriReta combines two investigational metabolic compounds with different biological targets.
Retatrutide is a triple receptor agonist acting on GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Together they allow researchers to investigate four complementary metabolic signalling pathways within a single experimental formulation.
Looking to buy CagriReta in Europe? LIFE Peptide supplies high-purity CagriReta for laboratory research with reliable EU-wide shipping.
Why CagriReta matters in metabolic research
Modern obesity research increasingly focuses on engaging multiple hormonal pathways rather than relying on a single mechanism.
The two components of CagriReta investigate complementary biology:
- GLP-1 receptor agonism
- GIP receptor agonism
- glucagon receptor agonism
- energy expenditure
- metabolic regulation
- amylin receptor signalling
- satiety biology
- gastric emptying
- appetite regulation
Together these pathways represent four distinct hormonal systems involved in metabolic regulation. However, current published evidence relates to the individual peptides, and dedicated studies evaluating the combined formulation are not yet available.
The two components of CagriReta
Retatrutide (10 mg)
A triple agonist investigated for simultaneous activation of GLP-1, GIP and glucagon receptors. Published clinical research has demonstrated substantial effects on body-weight regulation and metabolic outcomes, making it one of the most advanced next-generation incretin peptides under investigation.
Cagrilintide (5 mg)
A long-acting amylin analogue investigated for appetite regulation, satiety signalling and gastric emptying. Because it acts through amylin receptors rather than incretin receptors, it provides a complementary research pathway to GLP-1-based therapies.
Why researchers combine Cagrilintide with Retatrutide
One of the most active areas in metabolic research is combining peptides that target different physiological pathways rather than increasing activity at the same receptor.
Retatrutide already activates three metabolic receptors. Cagrilintide adds amylin signalling, a pathway not directly targeted by Retatrutide. This complementary receptor profile has made the combination increasingly popular in experimental metabolic research, although direct clinical evidence for the blend itself is currently unavailable.
Human and preclinical research
At present there are no published Phase II or Phase III clinical trials evaluating the CagriReta combination.
Instead, the scientific rationale is based on:
- extensive clinical investigation of Retatrutide
- Phase II and Phase III development of Cagrilintide
- successful investigation of amylin plus GLP-1 combinations such as CagriSema
For this reason, CagriReta should be regarded as a research blend built upon complementary metabolic mechanisms rather than as a formulation with its own clinical evidence base.
How CagriReta differs from other metabolic blends
CagriReta
- Cagrilintide
- Retatrutide
- Four metabolic pathways
- Amylin + GLP-1 + GIP + glucagon
- Cagrilintide
- Semaglutide
- Amylin + GLP-1
- Cagrilintide
- Tirzepatide
- Amylin + GLP-1 + GIP
Each formulation investigates a different combination of metabolic signalling pathways rather than representing successive versions of the same concept.
Published safety considerations
Published safety information for CagriReta is derived from studies of Cagrilintide and Retatrutide individually. Both peptides have primarily been associated with gastrointestinal adverse events, including nausea, vomiting and diarrhoea during dose escalation in clinical studies. Because the combined formulation has not been evaluated in dedicated clinical trials, safety observations should be interpreted according to the literature available for each individual component.
Product characteristics
Application: laboratory and analytical research
Use restriction: not for human consumption; not for medical, veterinary or cosmetic use
Produced in GMP-compliant facilities under strict QC protocols.
Each batch carefully lab tested after production (you can find Certificate of Analysis under product pictures).
Freeze-dried (lyophilized) for maximum stability and extended shelf life.
Sealed in sterile vials, ready for reconstitution.
Purity: ≥ 98% (HPLC)
Appearance: white lyophilized powder
Composition: Cagrilintide 5 mg + Retatrutide 10 mg
Molecular formula Cagrilintide / Retatrutide: C194H312N54O59 S2 / C221H342N46O68
Molecular weight Cagrilintide / Retatrutide: 4409.01 / 4731.4
Sequence Cagrilintide: {diacid-C20-γ-Glu} KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Sequence Retatrutide: Y{Aib}QGTFTSDYSI{α-Me-Leu}LDK-Lys{diacid-C20-γ-Glu-(AEEA)}-AQ{Aib}AFIEYLLEGGPSSGAPPPS-NH2
Storage: unopened lyophilized vials are best stored refrigerated at 2–8°C, which is the storage method confirmed by our manufacturing partner and suitable for up to 24 months. Refrigeration is preferred because it minimizes unnecessary freeze–thaw cycles during routine handling. If substantially longer-term storage is required, unopened lyophilized vials may also be kept frozen. Once reconstituted, always store at 2–8°C and do not freeze.
Reconstitution and handling
CagriReta is supplied as a lyophilised vial and should be handled using standard peptide reconstitution procedures appropriate to the research setting. Must be reconstituted with bacteriostatic water before use. To help preserve structural integrity, add the chosen solvent slowly against the inside wall of the vial rather than directly onto the peptide cake, and avoid vigorous shaking. Gentle swirling is generally sufficient once the peptide has fully dissolved. Standard laboratory practice also includes allowing refrigerated vials to reach room temperature before reconstitution to minimise condensation inside the vial.
For other solvent selection, concentration planning and storage guidance, see the full Peptide Reconstitution Guide and Reconstitution Calculator.
Key published studies
- Lau DCW, et al. Once-weekly Cagrilintide for Weight Management in People with Overweight or Obesity. The Lancet, 2021
Landmark Phase II trial establishing Cagrilintide as a leading long-acting amylin analogue.
- Jastreboff AM, et al. Triple-Hormone-Receptor Agonist Retatrutide for Obesity. New England Journal of Medicine, 2023
Pivotal Phase II trial demonstrating substantial weight reduction with triple receptor agonism.
- D’Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity. Cardiology in Review, 2024
Comprehensive review of amylin biology and Cagrilintide development.
- Katsi V, et al. Retatrutide—A Game Changer in Obesity Pharmacotherapy. 2025
Review of Retatrutide pharmacology, receptor profile and clinical development.
Frequently Asked Questions
What is CagriReta Blend?
CagriReta Blend combines Cagrilintide (5 mg) and Retatrutide (10 mg) in a single lyophilised vial. It is designed for laboratory research investigating complementary metabolic pathways involving amylin, GLP-1, GIP and glucagon signalling.
Which peptides are included in CagriReta?
Each vial contains:
- Cagrilintide – 5 mg
- Retatrutide – 10 mg
Together these peptides provide four complementary hormonal pathways commonly investigated in metabolic research.
Why are Cagrilintide and Retatrutide combined?
Retatrutide activates GLP-1, GIP and glucagon receptors, while Cagrilintide is a long-acting amylin analogue. Because these peptides target different physiological systems, researchers investigate the combination to explore broader metabolic signalling than either compound alone. Current published evidence, however, relates to the individual peptides rather than to the blend itself.
What research areas commonly investigate CagriReta Blend?
Based on the published literature for its individual components, CagriReta is relevant to research involving appetite regulation, satiety signalling, energy balance, body-weight regulation, gastric emptying, incretin biology and amylin receptor signalling.
How does CagriReta differ from CagriSema?
Both blends contain Cagrilintide, but CagriSema combines it with Semaglutide, whereas CagriReta combines it with Retatrutide. Retatrutide adds GIP and glucagon receptor agonism in addition to GLP-1 activity, giving CagriReta a broader receptor profile for metabolic research.
Can research on Cagrilintide and Retatrutide be applied directly to the blend?
Not necessarily. Both peptides have substantial independent clinical literature, but there are currently no dedicated large clinical studies evaluating the CagriReta formulation. Findings should therefore be interpreted according to the evidence available for each individual component.
Can I buy CagriReta in Europe?
Yes. We ship CagriReta to most European countries using reliable courier services. Available shipping methods and delivery times are shown during checkout based on your destination.
Is this product intended for human use?
No. CagriReta Blend supplied by LIFE Peptide is provided strictly for laboratory and analytical research. It is not intended for human consumption, diagnosis, treatment or prevention of disease. Any discussion of published studies summarises the scientific literature relating to the individual peptide components rather than the intended use of the combined formulation.
Related research context
Cagrilintide / Retatrutide represents an advanced multi-pathway research model combining amylin receptor signaling with triple-receptor incretin agonism (GLP-1, GIP, glucagon).
For structured comparison and deeper context, researchers may also examine:
• Retatrutide — triple-receptor agonist (GLP-1/GIP/glucagon)
• Cagrilintide — amylin analogue (satiety signaling pathway)
• Tirzepatide — dual incretin agonist (GLP-1/GIP)
• Semaglutide — GLP-1 receptor agonist
For broader mechanism comparison, see the GLP-1 metabolic research guide and explore the Metabolic рesearch category.
This blend is most relevant in studies investigating layered hormonal signaling and multi-receptor metabolic interaction frameworks.
NOTE: This is for educational reference only and does not constitute medical advice.
Disclaimer
This product is sold for research purposes only. It is not intended to diagnose, treat, cure, or prevent any disease. Buyer assumes full responsibility for proper handling and use.








